N5-Peptide Hepatitis C Synthesized Peptide NS5: ALPVWARPDYNPPLVETWKDPDYEPPVVHG-COOHApplications: Suitable for use in ELISA. Other applications not tested.Recommended Dilution:Optimal dilutions to be determined by the researcher.Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.